Protein coding transcript 129861

• Transcript: Ll_transcript_198181
• CDS coordinates: 15-326 (+)
• Peptide sequence: MDLSKVTLDIFSKLEHKWLSHYKGTDKTRILSIDGGGTNVIVSGAALIHLEDQIRIQTSDPHARIADFFDIVAGTGIGAILAAMITAADAFARPLHTARDAVRL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_198181

• Blastp: Probable inactive patatin-like protein 9 from Arabidopsis with 70.19% of identity
• Blastx: Probable inactive patatin-like protein 9 from Arabidopsis with 70.19% of identity
• Eggnog: Patatin group(COG3621)
• Kegg: Link to kegg annotations (AT3G63200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426631.1)
• Pfam: Patatin-like phospholipase (PF01734.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;