Protein coding transcript 129873

• Transcript: Ll_transcript_70474
• CDS coordinates: 36-347 (+)
• Peptide sequence: MSLIFRLAGRQACNQFLKNEKTGLLNLIRPVTLQAKPAQPPVKEGHDERNMRLKRPQSPHLTIYAPQLTSMLSISHRATGMVLGAYAVGLGMGALVFPDDIPCW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_70474

• Blastp: Succinate dehydrogenase cytochrome B subunit, mitochondrial from Schizosaccharomyces with 53.06% of identity
• Blastx: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial from Caenorhabditis with 33.02% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC330.12c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016188427.1)
• Pfam: Succinate dehydrogenase/Fumarate reductase transmembrane subunit (PF01127.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;