Protein coding transcript 129876

• Transcript: Ll_transcript_194813
• CDS coordinates: 45-482 (+)
• Peptide sequence: MPTRSTGTVTQDWNPVVLHKSKPKAHDLRNPKAVNQALRTGAEVQTIKKFDAGSNKKTAGPVIYARKLDEAAEPAALEKVAVEVRHAIQKARLEKKMSQSELAKLINERNQVVQEYENGKAVPNQLVLAKMEKVLGVKLRGKIGK*
• ORF Type: complete

Annotations of Ll_transcript_194813

• Blastp: Multiprotein-bridging factor 1c from Arabidopsis with 75.68% of identity
• Blastx: Multiprotein-bridging factor 1c from Arabidopsis with 75.68% of identity
• Eggnog: Factor 1(COG1813)
• Kegg: Link to kegg annotations (AT3G24500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448414.1)
• Pfam: Multiprotein bridging factor 1 (PF08523.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;