Protein coding transcript 129877

• Transcript: Ll_transcript_266165
• CDS coordinates: 26-397 (+)
• Peptide sequence: MTKVKCSDLRLKDKESLLKQLEELKQELANLRVSKVTGGTASKLSRIRVVRKAILRCYVVIHQKQKEALRKIFKNRKYKPLDLRPKLTRAKRRALTKKELSVKTMKEIKKKNKFPPRMYAVKA*
• ORF Type: complete

Annotations of Ll_transcript_266165

• Blastp: 60S ribosomal protein L35 from Ophiophagus with 64.23% of identity
• Blastx: 60S ribosomal protein L35 from Ophiophagus with 64.23% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004497317.1)
• Pfam: Ribosomal L29 protein (PF00831.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;