Protein coding transcript 129880

• Transcript: Ll_transcript_266246
• CDS coordinates: 3-488 (+)
• Peptide sequence: TSLLSKTSFFSWTRSDKKATKMSDVEVDETPSGPPVTGGAMDVNQALQEVLKTALIHDGVVHGLHEAAKALDKRQAQLCVLAENCDEPMYKKLVSALCSEHQIPLIKVDNNKKLGEWSGLCKIDNTGKARKVVGCSCVVIRDYGEESPGLDILKDYLKNAK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_266246

• Blastp: 40S ribosomal protein S12 from Sophophora with 70.29% of identity
• Blastx: 40S ribosomal protein S12 from Sophophora with 70.29% of identity
• Eggnog: (ribosomal) protein(COG1358)
• Kegg: Link to kegg annotations (Dmel_CG11271)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020232660.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;