Protein coding transcript 129881

• Transcript: Ll_transcript_266254
• CDS coordinates: 123-782 (-)
• Peptide sequence: ICFNPKKPSFSIAHNSNSSSSSTPHRLSFSDSIKKNVNNINNDENSFSIEAAEALIQKWNPDTSAYAKVTSLFYEDKTEAVQYINCVKKLHKLMHSLLIQNPSSEKLILSQNLMQIAMKRLKKEFYQILSMNRAHLDPESISVKSSRTSVCSSISDFDDDCTTAGDEIRAAGDAISEVERLSSIAMADLKVIADCMVSSRTCSLLEEAPVMYQRLLLLQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_266254

• Blastp: Exocyst complex component EXO70H1 from Arabidopsis with 43.93% of identity
• Blastx: Exocyst complex component EXO70H1 from Arabidopsis with 44.05% of identity
• Eggnog: exocyst complex(ENOG410YIGI)
• Kegg: Link to kegg annotations (AT3G55150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436848.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;