Transcript | Ll_transcript_239354 |
---|---|
CDS coordinates | 3-317 (+) |
Peptide sequence | NDGVVEIRKVLHFGSLNNVMMMVFGRSYEFGCGDYDGCEVEELVREGYDLLGMFNWSDHFPLLGWLDLQGVRKRCRNLVSRVNVFVGKIILEHRMKRVVVEGGEN |
ORF Type | internal |
Blastp | Cytochrome P450 78A5 from Arabidopsis with 64.21% of identity |
---|---|
Blastx | Cytochrome P450 78A5 from Arabidopsis with 64.21% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (AT1G13710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438954.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer