Protein coding transcript 129884

• Transcript: Ll_transcript_239354
• CDS coordinates: 3-317 (+)
• Peptide sequence: NDGVVEIRKVLHFGSLNNVMMMVFGRSYEFGCGDYDGCEVEELVREGYDLLGMFNWSDHFPLLGWLDLQGVRKRCRNLVSRVNVFVGKIILEHRMKRVVVEGGEN
• ORF Type: internal

Annotations of Ll_transcript_239354

• Blastp: Cytochrome P450 78A5 from Arabidopsis with 64.21% of identity
• Blastx: Cytochrome P450 78A5 from Arabidopsis with 64.21% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT1G13710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438954.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;