Protein coding transcript 129887

• Transcript: Ll_transcript_239360
• CDS coordinates: 2-343 (+)
• Peptide sequence: STPVLEDAAQKNNIAKMAQQEEALQSKDFEIIDHAIDTVSKEKKLIVEKGEIEELKAEMADYEEDVTDLKKVVSSQPKPEVQETKGARRLFKTVNKMIGRLDNVMVELEKKERQ
• ORF Type: internal

Annotations of Ll_transcript_239360

• Blastp: Mitochondrial proton/calcium exchanger protein from Sophophora with 40% of identity
• Blastx: Mitochondrial proton/calcium exchanger protein from Sophophora with 40% of identity
• Eggnog: Leucine zipper-ef-hand containing transmembrane protein(ENOG410XRSP)
• Kegg: Link to kegg annotations (Dmel_CG4589)
• CantataDB: -
• Mirbase: -
• Ncbi protein: -
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;