Transcript | Ll_transcript_117728 |
---|---|
CDS coordinates | 41-547 (+) |
Peptide sequence | MASDGSEEFKLVSPSISSEGRLPRHYTDEGQGAKKNISPPLEWYNLPQGTKTLALVVEDIDEPDSDGPIMSWTHWVVVNISPSVKKLPEGFSGKDEMGGEYAGIKEGNNDLKVPGWHGPRLASNGHRIQFKLYALDDEVHLGNKVTKEKLLDTIPGHVLGEAVLMAKY* |
ORF Type | complete |
Blastp | UPF0098 protein MTH_273 from Methanothermobacter with 38.75% of identity |
---|---|
Blastx | UPF0098 protein MTH_273 from Methanothermobacter with 38.75% of identity |
Eggnog | phosphatidylethanolamine-binding protein(COG1881) |
Kegg | Link to kegg annotations (MTH_273) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430872.1) |
Pfam | Phosphatidylethanolamine-binding protein (PF01161.19) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer