Transcript | Ll_transcript_117733 |
---|---|
CDS coordinates | 3-386 (+) |
Peptide sequence | KITQYSPSEAAKVYEKAVSRKSNSMFNPKATLAKLKEGSSPEILDQAQRKAIINQYLDFKQMMLKFDPDDAEEDEEGSPSKAAGGTPGRADNAGRAGVHTPYHQEGIVPPITLTINTSHGDNSPDKVR |
ORF Type | internal |
Blastp | Nipped-B-like protein B from Danio with 47.83% of identity |
---|---|
Blastx | Nipped-B-like protein B from Danio with 47.83% of identity |
Eggnog | Nipped-B homolog (Drosophila)(ENOG410XP32) |
Kegg | Link to kegg annotations (794108) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020228390.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer