Protein coding transcript 129889

• Transcript: Ll_transcript_117733
• CDS coordinates: 3-386 (+)
• Peptide sequence: KITQYSPSEAAKVYEKAVSRKSNSMFNPKATLAKLKEGSSPEILDQAQRKAIINQYLDFKQMMLKFDPDDAEEDEEGSPSKAAGGTPGRADNAGRAGVHTPYHQEGIVPPITLTINTSHGDNSPDKVR
• ORF Type: internal

Annotations of Ll_transcript_117733

• Blastp: Nipped-B-like protein B from Danio with 47.83% of identity
• Blastx: Nipped-B-like protein B from Danio with 47.83% of identity
• Eggnog: Nipped-B homolog (Drosophila)(ENOG410XP32)
• Kegg: Link to kegg annotations (794108)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020228390.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;