Protein coding transcript 129890

• Transcript: Ll_transcript_176540
• CDS coordinates: 2-304 (+)
• Peptide sequence: SLVAGDFVRVPLYRVQSARRQLQEVGTAVQQLRLRYGGPTPEPLSNYLDAQYYGPISIGNPPQSFKVVFDTGSSNLWVPSKKCHYTSIACLLHNKYDSTRS
• ORF Type: internal

Annotations of Ll_transcript_176540

• Blastp: Lysosomal aspartic protease from Stegomyia with 66.02% of identity
• Blastx: Lysosomal aspartic protease from Stegomyia with 66.02% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AaeL_AAEL006169)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016197480.1)
• Pfam: A1 Propeptide (PF07966.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;