Protein coding transcript 129891

• Transcript: Ll_transcript_176528
• CDS coordinates: 3-317 (-)
• Peptide sequence: SRPARLYDYEVHLDTEINDEGDLVHFALMALLAEAEPISEQDALKNSVWKATMEEELKSIEKNKTWDLIKLPHDKHKIGVKWVFKQKFNPDGSISKHKARLVAKV
• ORF Type: internal

Annotations of Ll_transcript_176528

• Blastp: Uncharacterized mitochondrial protein AtMg00820 from Arabidopsis with 47.83% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00820 from Arabidopsis with 47.83% of identity
• Eggnog: Retrotransposon protein(COG2801)
• Kegg: Link to kegg annotations (ArthMp071)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014522463.1)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF07727.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;