Protein coding transcript 129892

• Transcript: Ll_transcript_176542
• CDS coordinates: 2-340 (-)
• Peptide sequence: GGEIEDLISTKETAALSYGVREINFIVRECEKLVERFKHEMRQKNIKSSSTSSGTRLSKAVIQKDLETAQKKNFEQIILPSIFYAEDNGPIFHQDSIDFAQRLKRNVKESRDM
• ORF Type: internal

Annotations of Ll_transcript_176542

• Blastp: Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic from Arabidopsis with 45.95% of identity
• Blastx: Probable inactive ATP-dependent zinc metalloprotease FTSHI 5, chloroplastic from Arabidopsis with 45.95% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT3G04340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439926.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;