Protein coding transcript 129893

• Transcript: Ll_transcript_176541
• CDS coordinates: 3-314 (-)
• Peptide sequence: EAINYFNMMRMNGLFPDEATMVSLLQAFEILPLGRLVEAIHGVIFTCGLNENLTIVTTLLNLYSKLGKLIASHKVFAEISKPDKVAWTAMIAGYAMHGQGKEAI
• ORF Type: internal

Annotations of Ll_transcript_176541

• Blastp: Pentatricopeptide repeat-containing protein At5g40410, mitochondrial from Arabidopsis with 49.04% of identity
• Blastx: Pentatricopeptide repeat-containing protein At5g40410, mitochondrial from Arabidopsis with 49.04% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT5G40410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443616.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;