Protein coding transcript 129895

• Transcript: Ll_transcript_243531
• CDS coordinates: 1-366 (-)
• Peptide sequence: RLPYETYNNNLPRQVQHDKKIWSACTTLICFSIVEWHQTDRVKLQFGLVQEVPESPQNIDALHSVDKRGNQDTNWTFKHAQWIEHWSHRKNQVLEGLPIQSPFHTQQYMNWYRSNSRPFLSA
• ORF Type: internal

Annotations of Ll_transcript_243531

• Blastp: Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 42.31% of identity
• Blastx: Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 42.31% of identity
• Eggnog: Serine threonine-protein phosphatase 7 long form homolog(ENOG410YHBV)
• Kegg: Link to kegg annotations (AT1G48120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020231083.1)
• Pfam: Plant mobile domain (PF10536.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;