| Transcript | Ll_transcript_243533 |
|---|---|
| CDS coordinates | 1-303 (+) |
| Peptide sequence | KKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHF |
| ORF Type | internal |
| Blastp | Ras-like GTP-binding protein O-RHO from Diplobatis with 100% of identity |
|---|---|
| Blastx | Ras-like GTP-binding protein O-RHO from Diplobatis with 100% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422823.1) |
| Pfam | Ras family (PF00071.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer