Protein coding transcript 1299

• Transcript: Ll_transcript_358572
• CDS coordinates: 86-640 (+)
• Peptide sequence: MARDCNRGSTVGGGRGAGGAGCYQCGEFGHLARDCNRGSNAGVCYNCGGIGHMARDCTSGRNSGGGGGAGCYNCGGFGHMARDCLKGSNGGGGGGGSCYNCGEFGHMSRDCNIGSGNRDRAGGNGGGCYRCGEVGHLARDCNKEGGSYGGGNSGSYGGGNGGNRTCFNCGKPGHFARECVEASG*
• ORF Type: complete

Annotations of Ll_transcript_358572

• Blastp: DNA-binding protein HEXBP from Leishmania with 40.52% of identity
• Blastx: Cold shock protein 1 from Arabidopsis with 35.14% of identity
• Eggnog: zinc finger(COG5082)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424476.1)
• Pfam: Zinc knuckle (PF00098.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;