Protein coding transcript 129902

• Transcript: Ll_transcript_183399
• CDS coordinates: 42-383 (+)
• Peptide sequence: MFDQAQIQEFKEAFNMIDQNRDGFVDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENQGVIHEERLRELLISMGDRFSAED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_183399

• Blastp: Myosin regulatory light chain sqh from Sophophora with 89.47% of identity
• Blastx: Myosin regulatory light chain sqh from Sophophora with 90.55% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (Dmel_CG3595)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014512636.1)
• Pfam: EF-hand domain pair (PF13499.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;