Protein coding transcript 129907

• Transcript: Ll_transcript_243599
• CDS coordinates: 72-398 (+)
• Peptide sequence: MGSIGKRLADNLKSKEFRNYLLSTHFWGPVANWGIPIAAIADINKDPKYISGKMTVALCLYSAMFMRFALKVQPRNMLLFACHFTNEGAQLIQLSRFLKHEFSTNKEK*
• ORF Type: complete

Annotations of Ll_transcript_243599

• Blastp: Mitochondrial pyruvate carrier 1 from Bos with 66.67% of identity
• Blastx: Mitochondrial pyruvate carrier 1 from Homo with 66.67% of identity
• Eggnog: Brain protein 44-like(ENOG4111TU9)
• Kegg: Link to kegg annotations (767977)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428142.1)
• Pfam: Uncharacterised protein family (UPF0041) (PF03650.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;