Protein coding transcript 129909

• Transcript: Ll_transcript_264864
• CDS coordinates: 426-1136 (+)
• Peptide sequence: MCSRGHWRPAEDEKLRELVEHYGPHNWNAIAEKLRGRSGKSCRLRWFNQLDPRINRTPFTEEEEERLIASHRVHGNRWAVIARLFPGRTDNAVKNHWHVMMARMRRERSKLYAKQHVHHHTNSSSNPKDNHQSNYDITSFPSSFVDKYGYTCVKSYPFQFPNNFHFQHPASSSTMLQDKSQSVEFYDFLRVNTDQSNNSEVTDNTRRDEEEVNQDDVEQENKDGFPFIDFLSVGSS*
• ORF Type: complete

Annotations of Ll_transcript_264864

• Blastp: Transcription factor MYB52 from Arabidopsis with 56.2% of identity
• Blastx: Transcription factor MYB52 from Arabidopsis with 55.78% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT1G17950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457476.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;