Protein coding transcript 129910

• Transcript: Ll_transcript_235931
• CDS coordinates: 90-704 (-)
• Peptide sequence: RDGSASDGGADCLLPVGLEQFKEQIAALSFLLGSKCSGKNCHEEHTVKSSHGKLNLSSDDAKRELNHVGGESNGGTVTVTNADESHAIFPKEQSSFRSLPHREAHAGFKVNISKKEEEKIQKIESISVKFLRVVQRVNLSFEDSLVSNVLCKLVADIGRRSNQEFVIESAKLLAKTAEKDCQDDLDFSLNILVLGKSGVERVQP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_235931

• Blastp: Translocase of chloroplast 159, chloroplastic from Arabidopsis with 36.84% of identity
• Blastx: Translocase of chloroplast 159, chloroplastic from Arabidopsis with 48.61% of identity
• Eggnog: NA(ENOG410Y1GS)
• Kegg: Link to kegg annotations (AT4G02510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463019.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;