Protein coding transcript 129913

• Transcript: Ll_transcript_235934
• CDS coordinates: 391-840 (+)
• Peptide sequence: MTSLSSHNFAAVLPGDSVAGLVVANGVQSFLSLYNTLLVVRLVLTWFPNVPPAIVSPLSTVCDPYLNIFRGLIPPIGGTLDLSPILAFLVLNAFTSTAAALPAELPVSEQSEQGLAAPLQSTDIVITSQKDKWMRRMHGNRSTTSRRVN*
• ORF Type: complete

Annotations of Ll_transcript_235934

• Blastp: YlmG homolog protein 2, chloroplastic from Arabidopsis with 68.66% of identity
• Blastx: YlmG homolog protein 2, chloroplastic from Arabidopsis with 65.28% of identity
• Eggnog: integral membrane protein(COG0762)
• Kegg: Link to kegg annotations (AT5G21920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416947.1)
• Pfam: YGGT family (PF02325.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;