Transcript | Ll_transcript_235929 |
---|---|
CDS coordinates | 2-715 (+) |
Peptide sequence | KVLAGQIHLEKLTDLEATKKIIEEVEATLDNADGVTAVHGRFYLLASQYYRIQGDHAQYYRTALRYLGCIEVETLTEEVKHQHAFFLGLAALLGEGVYNLGELLAHPVLDSLKTTENAWLVELLFAFNSGNINKFEQMKSHWSAIADLAAQELFLRQKISLLCLMEMTFKRPSHNRQLTFAEISKETKLPINEIELLVMKALSQGLVKGAIDQVASTVNMTWVQPRVLDRTQITTMVD |
ORF Type | internal |
Blastp | 26S proteasome non-ATPase regulatory subunit 13 from Gallus with 61.33% of identity |
---|---|
Blastx | 26S proteasome non-ATPase regulatory subunit 13 from Gallus with 60.79% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (422990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014521188.1) |
Pfam | PCI domain (PF01399.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer