Protein coding transcript 129914

• Transcript: Ll_transcript_235929
• CDS coordinates: 2-715 (+)
• Peptide sequence: KVLAGQIHLEKLTDLEATKKIIEEVEATLDNADGVTAVHGRFYLLASQYYRIQGDHAQYYRTALRYLGCIEVETLTEEVKHQHAFFLGLAALLGEGVYNLGELLAHPVLDSLKTTENAWLVELLFAFNSGNINKFEQMKSHWSAIADLAAQELFLRQKISLLCLMEMTFKRPSHNRQLTFAEISKETKLPINEIELLVMKALSQGLVKGAIDQVASTVNMTWVQPRVLDRTQITTMVD
• ORF Type: internal

Annotations of Ll_transcript_235929

• Blastp: 26S proteasome non-ATPase regulatory subunit 13 from Gallus with 61.33% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 13 from Gallus with 60.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (422990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014521188.1)
• Pfam: PCI domain (PF01399.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;