Protein coding transcript 129915

• Transcript: Ll_transcript_199777
• CDS coordinates: 3-416 (+)
• Peptide sequence: PLDFMEFRNYLCPASGFQSLQFRLLENKLGVRQENRVKYNQNYTKVFGNDEGAMKAIESSESEPSLTDLVQSWLERTPGLEMEGFNFWGKYQDAVEVLLNEQKQLAEKEPCENVKQYHLSDLEKRREVYESIFKPEVH
• ORF Type: internal

Annotations of Ll_transcript_199777

• Blastp: Tryptophan 2,3-dioxygenase from Tribolium with 81.88% of identity
• Blastx: Tryptophan 2,3-dioxygenase from Tribolium with 81.88% of identity
• Eggnog: Catalyzes the oxidative cleavage of the L-tryptophan (L- Trp) pyrrole ring (By similarity)(COG3483)
• Kegg: Link to kegg annotations (654844)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020216254.1)
• Pfam: Tryptophan 2,3-dioxygenase (PF03301.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;