Protein coding transcript 129916

• Transcript: Ll_transcript_199784
• CDS coordinates: 2-331 (+)
• Peptide sequence: YKGEEKQISGEEISSMVLSKMKEVAEEYLGHAVKCAVITVPAYFNNSQRQATKDAGVIAGFNVLRIINEPTAAAIAYGLDKKSCRKGEQNVLVFDLGGGTFDVSLVTIDE
• ORF Type: internal

Annotations of Ll_transcript_199784

• Blastp: Heat shock 70 kDa protein from Soja with 82.73% of identity
• Blastx: Heat shock 70 kDa protein from Soja with 82.73% of identity
• Eggnog: Heat shock protein(COG0443)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439663.1)
• Pfam: Hsp70 protein (PF00012.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;