Protein coding transcript 129918

• Transcript: Ll_transcript_179724
• CDS coordinates: 1-321 (+)
• Peptide sequence: VYRKNCDEIIEYLLMQASYANYHWTPPKGHLEENESNMDAAIRETDEEAGIKLKDLSVDHNFEKVLKYDPKDKPFSKQVTYWLARLINPDTPVVLSNEHQDYKWLPL
• ORF Type: internal

Annotations of Ll_transcript_179724

• Blastp: Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] from Bos with 51.02% of identity
• Blastx: Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] from Bos with 51.02% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (768044)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013446850.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;