Protein coding transcript 129923

• Transcript: Ll_transcript_3049
• CDS coordinates: 1-405 (+)
• Peptide sequence: QEQVQVHLGPQVREGEIVFGVAHIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAVLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDATRRKG
• ORF Type: internal

Annotations of Ll_transcript_3049

• Blastp: 40S ribosomal protein S14b from Sophophora with 94.66% of identity
• Blastx: 40S ribosomal protein S14b from Sophophora with 94.66% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dmel_CG1524)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016190479.1)
• Pfam: Ribosomal protein S11 (PF00411.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;