Protein coding transcript 129925

• Transcript: Ll_transcript_3039
• CDS coordinates: 131-499 (+)
• Peptide sequence: MSLILYHDEDQKRIAEISFKKQENKTKEKLITVIAPAGPMYPAEDYHQKYRLQGHPSLCKDIGLTPELLQSSHIAAKLNGYVAGLGTIEDLEKIAAKYNLTEKITSYVRQQMKENEGGSLFC*
• ORF Type: complete

Annotations of Ll_transcript_3039

• Blastp: Peptide methionine sulfoxide reductase from Sophophora with 48.36% of identity
• Blastx: Peptide methionine sulfoxide reductase from Sophophora with 48.44% of identity
• Eggnog: Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity)(COG0225)
• Kegg: Link to kegg annotations (Dmel_CG7266)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016190424.1)
• Pfam: Peptide methionine sulfoxide reductase (PF01625.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;