Protein coding transcript 129927

• Transcript: Ll_transcript_165598
• CDS coordinates: 170-541 (+)
• Peptide sequence: MMCDIIYAGDKARFGQPEVSIGTIPGAGGTQSIARSCGKSKAMEICLSGNQFTAEEAERMGLVSKIFPADKLVDEAVKLGEKISSHSPLIIALCKESVKKAFETTLAEGLSFEKRIFHATFSTN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_165598

• Blastp: Probable enoyl-CoA hydratase, mitochondrial from Caenorhabditis with 70.73% of identity
• Blastx: Probable enoyl-CoA hydratase, mitochondrial from Caenorhabditis with 70.13% of identity
• Eggnog: Enoyl-CoA hydratase(COG1024)
• Kegg: Link to kegg annotations (CELE_T05G5.6)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020231208.1)
• Pfam: Enoyl-CoA hydratase/isomerase (PF00378.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;