Protein coding transcript 129932

• Transcript: Ll_transcript_86354
• CDS coordinates: 2-340 (+)
• Peptide sequence: QNNEFFAVGSKCSHYGAPLVKGALGNGTVRCPWHGACFNLKTGDIEDFPGLDSIPSFKVSVTNGNVKVSANKCALENAKFVKPLTKRNPENKCTFIVIGSGPAGTECVEKLRQ
• ORF Type: internal

Annotations of Ll_transcript_86354

• Blastp: Apoptosis-inducing factor 3 from Mus with 49.57% of identity
• Blastx: Apoptosis-inducing factor 3 from Mus with 49.57% of identity
• Eggnog: pyridine nucleotide-disulfide oxidoreductase(COG0446)
• Kegg: Link to kegg annotations (72168)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460667.1)
• Pfam: Rieske [2Fe-2S] domain (PF00355.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;