Protein coding transcript 129933

• Transcript: Ll_transcript_86359
• CDS coordinates: 2-643 (+)
• Peptide sequence: CYVKYQRVRILQNNMTYKLTYFDIPGLGEPIRWMFAMGKIEFEDIHIKKDDWSTFKPETPFGQLPLLEHNGKVVSQSMAICRYVGKLVGLGGKDAWEDLEIDFIVDCFSDFTGKLVAMVKETDEARKEELKKTVDEELLPFYLNKFEERTKTNKGYLVGGHLTWADVVISCLLKNFEKFTGGSIIENHPGLKKIQNEVLSNPEIKKHIESHSYT
• ORF Type: internal

Annotations of Ll_transcript_86359

• Blastp: Glutathione S-transferase from Anopheles with 39.9% of identity
• Blastx: Glutathione S-transferase from Anopheles with 39.9% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AgaP_AGAP010404)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020211272.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;