Protein coding transcript 129935

• Transcript: Ll_transcript_3211
• CDS coordinates: 2-355 (+)
• Peptide sequence: GNQNNFKTAEECNEQCGSAQDLCRLPPVVGPCNGEYEQYYYEEASDSCKTFLFGGCDGNYNRFADKSSCEQRCRKKRPDEYTTREPAPAQVPAEEYAMCYEQIDTGNCTEEYNAFAFD
• ORF Type: internal

Annotations of Ll_transcript_3211

• Blastp: Papilin from Caenorhabditis with 43.01% of identity
• Blastx: Papilin from Caenorhabditis with 43.01% of identity
• Eggnog: serine peptidase inhibitor, Kunitz type(ENOG410XQNP)
• Kegg: Link to kegg annotations (CELE_C37C3.6)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014492656.1)
• Pfam: Kunitz/Bovine pancreatic trypsin inhibitor domain (PF00014.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;