| Transcript | Ll_transcript_199134 |
|---|---|
| CDS coordinates | 3-311 (+) |
| Peptide sequence | HIAKVELEHKNLVAIDKLKLKHLEQDKRELLRDDQEGETNIGVLSNSSSRVDGLSYGQELKDIENVKSNQENSDIGEDASDGALWDIFRRQEVPKLQEYLKKH |
| ORF Type | internal |
| Blastp | Lysine-specific demethylase JMJ25 from Arabidopsis with 36.67% of identity |
|---|---|
| Blastx | Lysine-specific demethylase JMJ25 from Arabidopsis with 36.67% of identity |
| Eggnog | lysine (K)-specific demethylase(ENOG410XTAA) |
| Kegg | Link to kegg annotations (AT3G07610) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452598.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer