| Transcript | Ll_transcript_247444 |
|---|---|
| CDS coordinates | 190-531 (-) |
| Peptide sequence | MNTMHYINENFLVQSLLYFEQVFIKPWIEHTRRERELKGHLISEVLRHAQNDMVGSLCKDDGTPDEATIRRFVIKHHNYEMKCCHICMETVHLNYLDVHCLSLQFRSRTKDHN* |
| ORF Type | complete |
| Blastp | Sodium/calcium exchanger NCL1 from Oryza sativa with 41.82% of identity |
|---|---|
| Blastx | - |
| Eggnog | Calcium-binding EF hand family protein(ENOG410ZVKW) |
| Kegg | Link to kegg annotations (4325568) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449181.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer