Protein coding transcript 129945

• Transcript: Ll_transcript_3236
• CDS coordinates: 108-563 (+)
• Peptide sequence: MGRMHTPGKGISKSALPYRRSVATWLKASSEDVKDHIFKLAKKGLTPSKIGVILRDSHGVAQVRFVTGNKILRIMKAMGLAPGLPEDLYHLIKKAVAIRKHLERNRKDRDSKFRLILVESRIHRLARYYKRKSKIAPNWRYESSTASALVA*
• ORF Type: complete

Annotations of Ll_transcript_3236

• Blastp: 40S ribosomal protein S13 from Spodoptera with 85.43% of identity
• Blastx: 40S ribosomal protein S13 from Spodoptera with 85.43% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422293.1)
• Pfam: Ribosomal S13/S15 N-terminal domain (PF08069.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;