Protein coding transcript 129946

• Transcript: Ll_transcript_48804
• CDS coordinates: 89-415 (+)
• Peptide sequence: MGVDVTFLAEGDGATFPKRGQTVTVHYTGTLTDGKKFDSSRDRNKPFKFKIGKGEVIKGWDEGVAQMSIGSRAKLTCTPDYAYGALGHPGVIPPNATLIFDVELIKCE*
• ORF Type: complete

Annotations of Ll_transcript_48804

• Blastp: 12 kDa FK506-binding protein from Sophophora with 77.78% of identity
• Blastx: 12 kDa FK506-binding protein from Sophophora with 77.78% of identity
• Eggnog: Peptidyl-prolyl cis-trans isomerase(COG0545)
• Kegg: Link to kegg annotations (Dmel_CG11001)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016187677.1)
• Pfam: FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;