Protein coding transcript 129949

• Transcript: Ll_transcript_3246
• CDS coordinates: 55-375 (+)
• Peptide sequence: MEQPKNDDLQDGMSATEMINMGNGLTYNDFIILPGYIDFSPDQVTLASPLTKKINIKAPLVSSPMDTVTESDMAIAMALCGGIGIIHHNCLPSYQANEVLKVKKYKH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_3246

• Blastp: Inosine-5'-monophosphate dehydrogenase from Sophophora with 74% of identity
• Blastx: Inosine-5'-monophosphate dehydrogenase from Sophophora with 63.41% of identity
• Eggnog: Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0516)
• Kegg: Link to kegg annotations (Dmel_CG1799)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003624628.2)
• Pfam: IMP dehydrogenase / GMP reductase domain (PF00478.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;