Protein coding transcript 129950

• Transcript: Ll_transcript_59146
• CDS coordinates: 1-339 (-)
• Peptide sequence: RDKLQLARFSATRLGKDVLDLNDVTVSVSSDELGERTLLDKVTCSIGPGDRIGLVGVNGAGKTTLLNLFDGSRKPDSGRVKQGKTLRLAHLRQEVDDLDSTMTVLESVNDVKA
• ORF Type: internal

Annotations of Ll_transcript_59146

• Blastp: Energy-dependent translational throttle protein EttA from Haemophilus with 40.82% of identity
• Blastx: Energy-dependent translational throttle protein EttA from Haemophilus with 40.82% of identity
• Eggnog: (ABC) transporter(COG0488)
• Kegg: Link to kegg annotations (HI1252)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437249.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;