Protein coding transcript 129955

• Transcript: Ll_transcript_59119
• CDS coordinates: 81-788 (+)
• Peptide sequence: MYPLFDFFLVCMKTKMRTHFHSLPLLFFTLSLLLGQSRPDPDPIQDYCIADNTNTFFINGVPCINPKQASSSHFVTSALSKSGNTSSNKFGFSVTSTNTVNLPGLNTLGLVLVRVDIEGNGIVPPHSHPRASEVTICLKGQLLVGFIDTMNRVFTQNLKPGESFVFPKGLIHFLFNRDSKRPALALSGLNSQNPGVQLASVATFASKPPIPDPILQKAFQISDKELDMMRRNLGG*
• ORF Type: complete

Annotations of Ll_transcript_59119

• Blastp: Germin-like protein subfamily 1 member 1 from Arabidopsis with 55.12% of identity
• Blastx: Germin-like protein subfamily 1 member 1 from Arabidopsis with 55.39% of identity
• Eggnog: germin-like protein(ENOG410YBB0)
• Kegg: Link to kegg annotations (AT1G10460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445509.1)
• Pfam: Cupin (PF00190.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;