Protein coding transcript 129957

• Transcript: Ll_transcript_59138
• CDS coordinates: 3-356 (+)
• Peptide sequence: EKSLKLKEANKQRTYIAAVKDLDFWLGEVESLLTSEDSGKDLASVQNLMKKHQLVEADIQAHEDRIKDMNDQADSLIESGQFDVPSIQEKRSTINERYERIKNLAAHRQARLNEANTL
• ORF Type: internal

Annotations of Ll_transcript_59138

• Blastp: Spectrin alpha chain from Sophophora with 90.68% of identity
• Blastx: Spectrin alpha chain from Sophophora with 90.68% of identity
• Eggnog: Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069)
• Kegg: Link to kegg annotations (Dmel_CG1977)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003627965.1)
• Pfam: Spectrin repeat (PF00435.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;