Protein coding transcript 129964

• Transcript: Ll_transcript_59133
• CDS coordinates: 3-353 (+)
• Peptide sequence: GSVGPVGFPGSPGDVGAIGPPGFPGPPGSDGFPGIPGKDGPPGLMGFKGEPGNPAPYGEKGDKGDVGFSGEPGYPGSKGDKGERGYPGLEGMQGVQGLPGDRGMTGIPGKLGMPGIS
• ORF Type: internal

Annotations of Ll_transcript_59133

• Blastp: Collagen alpha-1(IV) chain from Sophophora with 52.21% of identity
• Blastx: Collagen alpha-1(XXVII) chain B from Danio with 61.84% of identity
• Eggnog: collagen, type(ENOG410XNMM)
• Kegg: Link to kegg annotations (Dmel_CG4145)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014507944.1)
• Pfam: Collagen triple helix repeat (20 copies) (PF01391.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;