Protein coding transcript 129969

• Transcript: Ll_transcript_59152
• CDS coordinates: 3-617 (+)
• Peptide sequence: LHFIISFFSQGYIAMEENSRESNEGAPKSIIPGGENDYFVCNICLGSVHDPVVTLCGHLYCWPCIYQRLRDANQPKTCLICNAEISLTSLVPLFGRGVSNSDSVARSNHMGLEIPPRPIPNNLTYMPTFPTNAPTYHQNQQLHDAASFPFPFHSNEVWLNFSNIRIYMLGQILATTRNEMEAHNFLNRAFIFLLCCVILCLLLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_59152

• Blastp: E3 ubiquitin-protein ligase RMA1 from Arabidopsis with 30% of identity
• Blastx: E3 ubiquitin-protein ligase RMA3 from Arabidopsis with 41.13% of identity
• Eggnog: Ring finger protein(ENOG4111IHV)
• Kegg: Link to kegg annotations (AT4G03510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017432584.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;