Protein coding transcript 129971

• Transcript: Ll_transcript_66660
• CDS coordinates: 2-574 (+)
• Peptide sequence: TTYSLSLNFPSNFTPKIKEMSDFNPSHLTMSPYPATFSKTNKSSMPMLYYGLAMVGAAAIAIILYNLINIITKMCNQSHMQSSQDEVVIDVAIGSSSMSFDNSRGNLLSSFKYKKENGGGDDYECSVCLSDLEEGEEVKKLPRCKHSFHVQCIDMWLHSHHDCPVCRTHVAHSCHQNVTQVMLATGGILV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_66660

• Blastp: RING-H2 finger protein ATL52 from Arabidopsis with 34.01% of identity
• Blastx: RING-H2 finger protein ATL52 from Arabidopsis with 34.01% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G17600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455151.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;