Protein coding transcript 129974

• Transcript: Ll_transcript_66643
• CDS coordinates: 57-464 (+)
• Peptide sequence: MSSLLNCVRLSKEICKNNKVILLAVRHHWNKDYKPGPYPKSEEEMAAAAKKYGLTRSEYKPYPDDGQGAGDYPNMPLVSADSKDPFYPWDNPELKRNFNEPLHREFDLMREDRYDVSAKLRWPMWIYWAQFLGVMA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_66643

• Blastp: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial from Bos with 45.45% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial from Bos with 45.45% of identity
• Eggnog: NADH dehydrogenase (ubiquinone) 1 beta subcomplex(ENOG4111WEY)
• Kegg: Link to kegg annotations (282517)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014498347.1)
• Pfam: NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8) (PF05821.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;