Protein coding transcript 129975

• Transcript: Ll_transcript_66657
• CDS coordinates: 128-433 (+)
• Peptide sequence: MSGRGCNSRKPVKVVIINTQYVETDATSFKSVVQKLTGKDSDYLEAKAEKAEREGVNNQVGVEVHAPEAGLGSSFLMRDVSFKEFDRFFSEMPSLNDIWAD*
• ORF Type: complete

Annotations of Ll_transcript_66657

• Blastp: VQ motif-containing protein 10 from Arabidopsis with 40.38% of identity
• Blastx: VQ motif-containing protein 10 from Arabidopsis with 40.38% of identity
• Eggnog: VQ motif(ENOG41115YH)
• Kegg: Link to kegg annotations (AT1G78410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430205.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;