Protein coding transcript 129978

• Transcript: Ll_transcript_66646
• CDS coordinates: 3-455 (-)
• Peptide sequence: MASSESSLNVPFLLLPSLATSLFFILLQIIIQTNVSSVSSKQIQTQDLLILPLKVQTLPLPSSRKLTFHHNVTLTISLTVGTPPQNVTMVLDTGSELSWLHCKNNNNLNSIFNPLLSSSYTPTPCTTSICTTRTRDFPIPVSCDLNKLCHV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_66646

• Blastp: Aspartic proteinase PCS1 from Arabidopsis with 59.81% of identity
• Blastx: Aspartic proteinase PCS1 from Arabidopsis with 54.21% of identity
• Eggnog: aspartic(ENOG410XNV7)
• Kegg: Link to kegg annotations (AT5G02190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461846.1)
• Pfam: Xylanase inhibitor N-terminal (PF14543.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;