Transcript | Ll_transcript_66666 |
---|---|
CDS coordinates | 150-509 (+) |
Peptide sequence | MAGLQRSAVSFRRQGSSGFVWDDKFLTEEFNKVNQQNEEQQHEQGEIKAHATTSLGSVNTTMERSRSTGGSSRGYRTGKVSPAIDPPSPKLSACGFCSAFGKHGDKGSQRSRPGKRRIR* |
ORF Type | complete |
Blastp | MAPK kinase substrate protein At1g80180 from Arabidopsis with 48.55% of identity |
---|---|
Blastx | MAPK kinase substrate protein At1g80180 from Arabidopsis with 42.75% of identity |
Eggnog | NA(ENOG410ZGQ8) |
Kegg | Link to kegg annotations (AT1G80180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443387.1) |
Pfam | Domain of unknown function (DUF4666) (PF15697.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer