Protein coding transcript 129981

• Transcript: Ll_transcript_66665
• CDS coordinates: 62-559 (+)
• Peptide sequence: MMGIVAALGVISPFPFYYWLWNWPQSWVHLCGKEKDPSKVMAHVAHFLKLLQFIALFSVSQFYWPPPLYFWPIFAFGQFLNFRVYQLLGEAGTYYGVRFGKTIPWVTEFPFGVIQDPQYVGSIMSLLACLCWVPFQYILLWVLGYVFMIHVESKEDQSTRAKPLH*
• ORF Type: complete

Annotations of Ll_transcript_66665

• Blastp: Phosphatidyl-N-methylethanolamine N-methyltransferase from Arabidopsis with 75.61% of identity
• Blastx: Phosphatidyl-N-methylethanolamine N-methyltransferase from Arabidopsis with 75.61% of identity
• Eggnog: NA(ENOG4111JRB)
• Kegg: Link to kegg annotations (AT1G80860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454544.1)
• Pfam: Phospholipid methyltransferase (PF04191.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;