Protein coding transcript 129988

• Transcript: Ll_transcript_42134
• CDS coordinates: 1-504 (+)
• Peptide sequence: QKLDESLTYQQFLAKVEEEEAWISEKQQLLSVDDYGDTMAAVQGLLKKHDAFETDFAAHRDRCADISSAGSELVEAGNHHADSITQRCQQLEKKLENLAALAQNRHANLMDNSAYLQFMWKADVVESWIADKETHVRSEEFGRDLSTVQTLLTKQETFDAGLHAFEHE
• ORF Type: internal

Annotations of Ll_transcript_42134

• Blastp: Spectrin alpha chain from Sophophora with 81.55% of identity
• Blastx: Spectrin alpha chain from Sophophora with 81.55% of identity
• Eggnog: Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069)
• Kegg: Link to kegg annotations (Dmel_CG1977)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020239253.1)
• Pfam: Spectrin repeat (PF00435.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;