| Transcript | Ll_transcript_42128 |
|---|---|
| CDS coordinates | 1-321 (+) |
| Peptide sequence | VLDVVAKFGAKADENTDLSQPLLDAWKEACASTTPTKILIPKGTYLLSKANLEGPCKAPIELQVQGTVKAPADPSAFKEPNWVVFNNIDGFTMSGGGVFDGQGPAAW |
| ORF Type | internal |
| Blastp | Polygalacturonase from Gossypium with 73.58% of identity |
|---|---|
| Blastx | Polygalacturonase from Gossypium with 73.58% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017406075.1) |
| Pfam | Glycosyl hydrolases family 28 (PF00295.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer